SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150402957|ref|YP_001330251.1| from Methanococcus maripaludis C7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150402957|ref|YP_001330251.1|
Domain Number 1 Region: 11-97
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.85e-22
Family Transcription factor E/IIe-alpha, N-terminal domain 0.0019
Further Details:      
 
Weak hits

Sequence:  gi|150402957|ref|YP_001330251.1|
Domain Number - Region: 122-152
Classification Level Classification E-value
Superfamily RNA polymerase subunits 0.00146
Family RBP12 subunit of RNA polymerase II 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150402957|ref|YP_001330251.1|
Sequence length 185
Comment transcription initiation factor E subunit alpha [Methanococcus maripaludis C7]
Sequence
MNLSKDEIFTMLENPLIQQVLFEIMDEDVVGFDVLSVLINTNEVTDDEISRQLDVKLNNI
RRILYKLYEARLVDYNREKDEETNWYTYTWKPSLEKVPALVAKKMKNVLKDLKEQLELEE
TNMFFFCSDCEIKFTFEDAMDSGFRCPQCGGMMYEYDNKKDISILKEQINYLEDEFNKNP
LFSAY
Download sequence
Identical sequences gi|150402957|ref|YP_001330251.1| 426368.MmarC7_1033 WP_011977413.1.31125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]