SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150402972|ref|YP_001330266.1| from Methanococcus maripaludis C7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150402972|ref|YP_001330266.1|
Domain Number 1 Region: 168-291
Classification Level Classification E-value
Superfamily CBS-domain pair 3.41e-28
Family CBS-domain pair 0.0006
Further Details:      
 
Domain Number 2 Region: 3-80
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000334
Family Heat-inducible transcription repressor HrcA, N-terminal domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150402972|ref|YP_001330266.1|
Sequence length 303
Comment signal transduction protein [Methanococcus maripaludis C7]
Sequence
MELTIVQKEILQELISIYREKNKAVKGTEIAVRLSRNPGTIRNQMQALRALNLVDGVPGP
KGGYIPTSLTYRSLGLETEEEITVPIYKREDLVEGVSVTKIVFDTVTREKSCSSKIYVNG
DTRKFSEGDVVKVGPTHHNKIVILGRIVGRDDINHILLMDVISVASVPGISVGDVGIKKE
LIYITPEKTIRDAAKLLFDANISGIPVMDGKKLLGVLSLHDVAEAVAKGLENENVTKLMA
EKIYTVSKNEKIYDALILMEKHNVGRLIILDNEEYAIGILTRTDILNLIEGTIFPKILKK
YLK
Download sequence
Identical sequences A6VI39
426368.MmarC7_1049 gi|150402972|ref|YP_001330266.1| WP_011977428.1.31125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]