SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150403079|ref|YP_001330373.1| from Methanococcus maripaludis C7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150403079|ref|YP_001330373.1|
Domain Number 1 Region: 2-138
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.74e-53
Family Rps19E-like 0.0000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150403079|ref|YP_001330373.1|
Sequence length 141
Comment 30S ribosomal protein S19e [Methanococcus maripaludis C7]
Sequence
MVTVYDVPANDLIAKLAEKLKEMGVEEPEWTSFVKTGAHKERRPDNEDWWYVRCAAILRK
VYINGPVGVERLRSVYGGRKNRGCAPEKFVKGSGNIIRTAFQALEAKDLLAKAENGGRII
APKGQSLVDNTAKEVADSVAQ
Download sequence
Identical sequences A6VIE6 A9A8D8
426368.MmarC7_1156 444158.MmarC6_0794 gi|150403079|ref|YP_001330373.1| gi|159905181|ref|YP_001548843.1| WP_011977533.1.31125 WP_011977533.1.31524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]