SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150403137|ref|YP_001330431.1| from Methanococcus maripaludis C7

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|150403137|ref|YP_001330431.1|
Domain Number - Region: 96-134
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00707
Family MarR-like transcriptional regulators 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150403137|ref|YP_001330431.1|
Sequence length 136
Comment hypothetical protein MmarC7_1217 [Methanococcus maripaludis C7]
Sequence
MVKPETGELNRFQLNLLSAFEGNVLSLDEIEKLYIEHKLKHYGEDRESVKELIFDLEKGF
FKLNDEVIKEYVETLYNVYNSPCKESIDRYEMILEDIGFKKVEKYLKDLENSAYISKLGD
GYNITEKGSEMLKHKK
Download sequence
Identical sequences A6VIK4
426368.MmarC7_1217 WP_011977590.1.31125 gi|150403137|ref|YP_001330431.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]