SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150403320|ref|YP_001330614.1| from Methanococcus maripaludis C7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150403320|ref|YP_001330614.1|
Domain Number 1 Region: 390-446
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000171
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.091
Further Details:      
 
Weak hits

Sequence:  gi|150403320|ref|YP_001330614.1|
Domain Number - Region: 212-396
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0956
Family Extended AAA-ATPase domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150403320|ref|YP_001330614.1|
Sequence length 452
Comment regulatory protein MarR [Methanococcus maripaludis C7]
Sequence
MSKPISTNYRIYLIIALIFCSISTVDSYRFDEYSVQYTIDQNDNFYEIIDLKIYNNNSDD
LYDISYSIPQETSDLTFNSSKGIDSYSITTNDAGVTEVNVKLDEPIGAWQSGDLSISFNG
QVSDLSGKKQVYIIVPAYDSNFKVSVQLPEGAAIVSPVKDVLSINPRDYTVGTNGKSIFV
EWEKELTSDEKYFEVTINYVMTAITPVITEDNNENLYRAISIVLGVLVVALIFFIYRNYN
KVKMINELQNEIIGLNKGLEISQLNLQNKNKEIRRLEELNDHVLKELDLSKNTLTEYESK
ISELKEKIMEFKAQLENFAKLKEEVISKDSEIKNLSSYKKLSEELKIKITELNEILEEKE
DYILELMGRIGDYESHKSETLMNILTDDEKGLIELIREHGSISQKEIVDITGLTKPKVSR
MISDLEQRGMVRKVKIGRINKIAISEDLDGSI
Download sequence
Identical sequences A6VJ37
WP_012067929.1.31125 gi|150403320|ref|YP_001330614.1| 426368.MmarC7_1400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]