SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150403374|ref|YP_001330668.1| from Methanococcus maripaludis C7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150403374|ref|YP_001330668.1|
Domain Number 1 Region: 32-233
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.52e-20
Family Extended AAA-ATPase domain 0.049
Further Details:      
 
Weak hits

Sequence:  gi|150403374|ref|YP_001330668.1|
Domain Number - Region: 213-276
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00998
Family Transcriptional regulator IclR, N-terminal domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150403374|ref|YP_001330668.1|
Sequence length 423
Comment ATPase [Methanococcus maripaludis C7]
Sequence
MELRDAIKSIIKEYEQRGVSLNERNLKLPETNKAISVVGIRRSGKTSILMKLFKETENAI
FFPLDDDRVFPVTLDTLQEIVKVSKEIYPNEKITFFFDEIQEIENFELVIKRLVEKEDYK
VYLTGSSSKLLSKEIATQLRGRSLSVEVFPLSFKEYLDFKKITLTDILTEQEHANILNNL
ENYLNYGGFPEIVLEEENREDILKNYFDMVVYKDIIERYNVKNTDSLRLFLKFLINSNTK
KVSINKLANNFKSMGFSVSKNTLYEYLSHLNDSYVIFPLKKYAYSLKESSLSLMKSYVID
NGFIKMYDFKNSSDIGKYLENAVFIELRRRGLFENQELFYYEDDIGEVDFLVKQNEHVSK
LINVCYNLNFENYDREIKKLVKIAKKIKCNELYLITFDQEQEITEDGILVKSIPFWKFID
LEI
Download sequence
Identical sequences A6VJ91
WP_012067982.1.31125 gi|150403374|ref|YP_001330668.1| 426368.MmarC7_1454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]