SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150403375|ref|YP_001330669.1| from Methanococcus maripaludis C7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150403375|ref|YP_001330669.1|
Domain Number 1 Region: 152-347
Classification Level Classification E-value
Superfamily Fic-like 1.31e-34
Family Fic-like 0.0094
Further Details:      
 
Domain Number 2 Region: 362-427
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000987
Family MarR-like transcriptional regulators 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150403375|ref|YP_001330669.1|
Sequence length 429
Comment filamentation induced by cAMP protein Fic [Methanococcus maripaludis C7]
Sequence
MKLPKIPKYSKENIEIALKYVPNREIIDIVQKYNEKYLHFNELKHKTLPIDPVIIWTIMK
MFRMNNLKSIHFGKWTFNYSLIDEFIEKLHTLDKSASGNLSTALESIPSEKERYIIDSLM
EEAIASSQIEGAVTTRKVAKEMLKKGQKPKNKDQKMILNNYNTMKYILEIKNKEFSISEI
LKIHKIITDGTLEDPEFVGKFRKNNEIAVYSTDGTLLHEPPKYELVESLMNNLCEFSNSK
DKFIHPIIKGIIIHFLIGYIHPFNDGNGRTARSLFYWYLLKNDYWLFEYMAISRVINGSK
GQYRDAYLKTESDTFYKDDKGDLTYFIKYNLECICRSLDEILEYLSKKQVEQKEVLNLIN
KSEDLNLRQAEILKEILKTPENIITIKEIVTTYNVAYATGRADLNHLVDLGYLEKKKAGK
EFVYVLNKK
Download sequence
Identical sequences A6VJ92
gi|150403375|ref|YP_001330669.1| 426368.MmarC7_1455 WP_012067983.1.31125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]