SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150403462|ref|YP_001330756.1| from Methanococcus maripaludis C7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150403462|ref|YP_001330756.1|
Domain Number 1 Region: 146-199
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000579
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150403462|ref|YP_001330756.1|
Sequence length 206
Comment hypothetical protein MmarC7_1547 [Methanococcus maripaludis C7]
Sequence
MSSKVKIAIYMLIFIVSVIVLTSKFLYPPTVQVIVQGDTTYVQDVPNVYTLYDCMLMVLA
SFSLCLSTTLIYFTVRDLELSEKNSVNKIDLSDLNDHIGKIVSSKVDDKLNGNINEIQKV
EVETESRNTENEEKLRKENFIKILKGNEKTIVKILMDHGEMTQSELFERTKIPKSTLSRT
LSDLELRGIILRYEHGISKKVKLNKI
Download sequence
Identical sequences A6VJH9
WP_012068069.1.31125 426368.MmarC7_1547 gi|150403462|ref|YP_001330756.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]