SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150403465|ref|YP_001330759.1| from Methanococcus maripaludis C7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150403465|ref|YP_001330759.1|
Domain Number 1 Region: 112-163
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.00000000206
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.035
Further Details:      
 
Domain Number 2 Region: 37-134
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000179
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150403465|ref|YP_001330759.1|
Sequence length 225
Comment DNA polymerase subunit beta [Methanococcus maripaludis C7]
Sequence
MVICCQKLVTYIYLKIYILVMNALDKLYRAYYAANKSKLYFSELKELTGLSNSSLQNALR
KLESEKQILKLKEKSNTYYILKNTKKTVFKFSEIDDERFWKLNRNVRAPILDFLENFPKE
IDFMILFGSASRKKETEDSDIDLMVITHSFEDPDLQKRYREEINQKLEYAKSKAESRAIY
PLSIVAVELNYFLTSKDHIVEQAKLTGFPVFGHQNYHEVILNVKR
Download sequence
Identical sequences A6VJI2
426368.MmarC7_1550 gi|150403465|ref|YP_001330759.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]