SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150403567|ref|YP_001330861.1| from Methanococcus maripaludis C7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150403567|ref|YP_001330861.1|
Domain Number 1 Region: 12-107
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000441
Family Iron-dependent repressor protein 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150403567|ref|YP_001330861.1|
Sequence length 132
Comment transcriptional regulator TrmB [Methanococcus maripaludis C7]
Sequence
MSKTIESVEKTLIANVSSLLSSEVRAKIYIFLRMYPESTVDEIAKGTGIYPSTIRESIFE
MYNEEYVIRKKMDRDGLGKKPYLYSAIDPVEIVKLISESIKEKLNDLASIDEKVSGKHIE
TTLKVAIKIESN
Download sequence
Identical sequences A6VJT4
gi|150403567|ref|YP_001330861.1| WP_012068170.1.31125 426368.MmarC7_1652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]