SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150403570|ref|YP_001330864.1| from Methanococcus maripaludis C7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150403570|ref|YP_001330864.1|
Domain Number 1 Region: 65-132
Classification Level Classification E-value
Superfamily Iron-dependent repressor protein, dimerization domain 4.45e-25
Family Iron-dependent repressor protein, dimerization domain 0.0012
Further Details:      
 
Domain Number 2 Region: 3-62
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000563
Family Iron-dependent repressor protein 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150403570|ref|YP_001330864.1|
Sequence length 134
Comment iron dependent repressor [Methanococcus maripaludis C7]
Sequence
MVSQNIEDYLENIFLFIRENKRPIKTTELAKLMNVQPAAVTSMAKKLHGDGLIDYQPYIG
INLKESGEKIAKETIRKHRIIECFLTEILGLDLEFAQEEACKIEHAVSDKTIEKLYEFID
RPEKCPHGYKINLK
Download sequence
Identical sequences A6VJT7
WP_012068173.1.31125 gi|150403570|ref|YP_001330864.1| 426368.MmarC7_1655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]