SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150403698|ref|YP_001330992.1| from Methanococcus maripaludis C7

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|150403698|ref|YP_001330992.1|
Domain Number - Region: 447-516
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00718
Family HxlR-like 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150403698|ref|YP_001330992.1|
Sequence length 519
Comment putative transcriptional regulator [Methanococcus maripaludis C7]
Sequence
MLPIPISQLLETNLIEEERLELKQGFNPEDIIHTMCAFANDFNNWGGGYIIIGIHDKTKE
VIGVNPSEIDTILKKMIGLSNKIHYPYFPVVEPIIYKNKTILVIACPGGPARPYKAPTSL
GKNSEYKYYIRRNSSTVIAKHEDEKELIGMSNQIPYDDQINHKASINDLNLHLIKQYLKE
INSNLDPEILKFEELCKSLNIVDGPKEYLKPKNIGLLLFSTDPKKFIKTPWIEVTVFYDE
IGDKFDEDVFDGDLVSQIRLSLNYIKSIAIRERVQKIPGIAESKRIYSYPFEAIEEALVN
AVYHKSYEIDAPIEIRIETDRIDIISYPGPLPPLNKYNLNDDIVISKRYRNRRIGDFLKE
FKLTEGKNTGFRKIKYALKNNGSPEPEFITDDERTQFIARLRIHPEFIEDVKKTQVKTQV
KTQVKTQVKTQVKTQVKTQVKTQAEDEILLVLKDIEMSSSEILSEIGLKSRTKRFKQAIS
NLLENNLIELTIPDKITSSKQKYRITKKGLKLLNDLSNG
Download sequence
Identical sequences A6VK65
426368.MmarC7_1786 gi|150403698|ref|YP_001330992.1| WP_012068294.1.31125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]