SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150403701|ref|YP_001330995.1| from Methanococcus maripaludis C7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150403701|ref|YP_001330995.1|
Domain Number 1 Region: 6-144
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.45e-25
Family MarR-like transcriptional regulators 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150403701|ref|YP_001330995.1|
Sequence length 165
Comment MarR family transcriptional regulator [Methanococcus maripaludis C7]
Sequence
MNILKNMDKIWEFMYIASRNYLYTKIPEEEVSNFTLADREYLETINRMKNPKISELAEKM
GYTNAAITKMTQKLEKKDYVKRIKSEEDKREVIIELTEKGNFMFRWKEEMNLATIDEFSK
ALTPEELETLDKLYEKIGTHLNKKLSLIYSQNPCGKKIEGRIISL
Download sequence
Identical sequences A6VK68
WP_012068297.1.31125 gi|150403701|ref|YP_001330995.1| 426368.MmarC7_1790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]