SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150403711|ref|YP_001331005.1| from Methanococcus maripaludis C7

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|150403711|ref|YP_001331005.1|
Domain Number - Region: 5-88
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0622
Family CAP C-terminal domain-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150403711|ref|YP_001331005.1|
Sequence length 101
Comment hypothetical protein MmarC7_1801 [Methanococcus maripaludis C7]
Sequence
MRENMINNFQRNILNYLYLMYKSGSPVCEFGNFITYFKECSQDKLIKNLKKLSKMNLIQI
QGDLVEKQLDKVQVNYSIFIKITDYGITNIEYPKKSPWIEF
Download sequence
Identical sequences A6VK78 A9A7I9
gi|150403711|ref|YP_001331005.1| WP_012068307.1.31125 WP_012068307.1.31524 426368.MmarC7_1801 444158.MmarC6_0113 gi|159904507|ref|YP_001548169.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]