SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|115522444|ref|YP_779355.1| from Rhodopseudomonas palustris BisA53

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|115522444|ref|YP_779355.1|
Domain Number 1 Region: 1-200
Classification Level Classification E-value
Superfamily HAD-like 3.57e-34
Family YihX-like 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|115522444|ref|YP_779355.1|
Sequence length 210
Comment HAD family phosphatase [Rhodopseudomonas palustris BisA53]
Sequence
MLEAVIWDFGGVLTTSPFEAFTRFETARGLPADLIRRTNAANHLENAWAKFERAEIDIDA
FDEMFAAESRALGAEVRGRDVLPLLAGELRPEMVEALKRIAATLKTGCITNNLPANAIGS
LGGSFYVGQVMALFDHVIESAKIGLRKPDPKIYRMMVEALGVDPSACVYLDDIGVNLKPA
REMGMKTIKVLDATQAIIDLEDATGLALRS
Download sequence
Identical sequences Q07UK9
WP_011661869.1.72802 gi|115522444|ref|YP_779355.1| 316055.RPE_0416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]