SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|116686471|ref|YP_839718.1| from Burkholderia cenocepacia HI2424

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116686471|ref|YP_839718.1|
Domain Number 1 Region: 107-247
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 4.97e-20
Family GntR ligand-binding domain-like 0.018
Further Details:      
 
Domain Number 2 Region: 17-88
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000256
Family GntR-like transcriptional regulators 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116686471|ref|YP_839718.1|
Sequence length 285
Comment GntR family transcriptional regulator [Burkholderia cenocepacia HI2424]
Sequence
MVMDRARAGLAVEIKQPKRADLVAEEIKRLITEKDLKPGDRLPREAELQQLYAVSKSTIR
EALKSLEVQGLIKVTTGPSGGGMVVEVPLDRTLQLLQNYLFFKDVTIDDIYTVRKLLEPE
LAAGAVPHLTERDFAALESNIACCDGGSGVHDRGHMLRQRQEDTTFHDILAAANPNPFLR
FSCELINEMIRQLIEFRNDTPLAEHKRFGEANVSIHKAILQAARERDVERVRALMVEHMT
EAPKHVKRMKGKLRGRLILDSEIRRRAAAAPVAESGTAAADPEER
Download sequence
Identical sequences A0A0H2Y0Z6 A0A1U9N4X0
WP_011549274.1.101155 WP_011549274.1.27194 WP_011549274.1.43430 WP_011549274.1.44577 WP_011549274.1.5376 WP_011549274.1.96618 gi|107028476|ref|YP_625571.1| 331271.Bcen_5729 331272.Bcen2424_6093 gi|116686471|ref|YP_839718.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]