SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|124027008|ref|YP_001012328.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124027008|ref|YP_001012328.1|
Domain Number 1 Region: 95-244
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 2.62e-21
Family Dihydroorotate dehydrogenase B, PyrK subunit 0.0048
Further Details:      
 
Domain Number 2 Region: 6-79
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 0.0000107
Family Ferredoxin reductase FAD-binding domain-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|124027008|ref|YP_001012328.1|
Sequence length 257
Comment dihydroorotate dehydrogenase electron transfer subunit [Hyperthermus butylicus DSM 5456]
Sequence
MQRYSYHSVELVRILWRGPRQVMLEYRYLDSAPSLSPGQFILFWVPGSEAIPLTPLYSDA
SRLVLLVVERGPTTARLVSSPPRHAGVIAVLGRRFTYRGDEMVFLAGGVGVAAVAMAARE
AAQSGVRVTVFYGARSAGELAPVEEFLGGARVIYATDDGSRGLRGTVLDALHASGLRVGD
VYTVVAGPKPLLCRAYSEAAEAGQLERLALSIETMVRCGLGFCGSCTIPCTGMLLCRDGP
VVPAVRLGCWVVRECQN
Download sequence
Identical sequences A2BJ22
gi|124027008|ref|YP_001012328.1| 415426.Hbut_0108 WP_011821300.1.50451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]