SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|124027265|ref|YP_001012585.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124027265|ref|YP_001012585.1|
Domain Number 1 Region: 46-191
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.84e-21
Family ATP-dependent protease Lon (La), catalytic domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|124027265|ref|YP_001012585.1|
Sequence length 693
Comment serine protease [Hyperthermus butylicus DSM 5456]
Sequence
MRVYLAAMVLAFLAASLALPVAAGAVGGSSGYVWMRSVHVIVPAVAMVDGRYVGVLSELI
VTVAWPGNGTVYFAADPLTELDTQAAARMAVLVASMLAGVDYHSYDYFIHLRAESPIVGG
PSASGAMAVAVLAALRGKSIPSNFSMTGMVDPDATLGPVGGIPQKLEAVAEKGVKLFVIP
ASQAFAHDLNTGGLVDVRALGEQLGVKVEPTLTILDAYVAATGDRELAKDTVWVWSLSYP
GWLAESLNDTAARFAALAGGNLTCWNSLARGLAGLPPSLISDLEAVAGEAARLLALSRQY
LGNGSYYSAASAAFRAAISATYACLAGKALASRNLVGELVNDAERLVNASLTLLGEANQT
VVSSVNGNLTDVALQIAITAYSRLQDAYDTVERAQQYVRAVAVADRYTAPVYALKALYYS
VYGYYRALTALQWAKLISEARSYGSPVTVEKLTEAIHTYLYFARSGAEYLETLGVDTSEL
MQTISQAYAVLEEANTVLDMLHALSLTVRSLADLAALLHSAFSVSVENAVAAAEVSLNQL
LALVLRRQGVTPLIPLMYREYAGTLADMQAKLALYVEAASYTILLSTLAAKPAAPPEQGA
QQPANATCSCNCTYPATVQSSQPVVAGGAENTANTSTTIAGTQQEATTTANATGTGVAVA
GGGVPLVPALNMVLVALVFLALGIALGVVASRV
Download sequence
Identical sequences A2BJS9
gi|124027265|ref|YP_001012585.1| 415426.Hbut_0368 WP_011821558.1.50451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]