SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|124027282|ref|YP_001012602.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|124027282|ref|YP_001012602.1|
Domain Number - Region: 11-148
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.0022
Family GHMP Kinase, N-terminal domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|124027282|ref|YP_001012602.1|
Sequence length 299
Comment hypothetical protein Hbut_0390 [Hyperthermus butylicus DSM 5456]
Sequence
MSLRASFSSSSAPVAVGLPGSFAGVVGAALDSAVVRVWVEVLGLEGLSVSVSGGSDTVRR
AVYYAATGLLEMLGEEAALSISVDDGGAVVGAEAAAAAATVASLSKLLGVAPDSRDLMVV
ANRAVASATGRPQAPLVAASLLGGIAVGTEQPAFMARVYAGALPLHIGVVVPCRQASLAE
VCIAADRYLELAQDAALALLLLSTEGWRIEFSELLVNESPWDFAAPEDVKRARREALSAG
AYAAGLDPYTGSLIVIGSEEAIDRAASIIAAWQECKPRILTGRIASQGALGPGEESSSE
Download sequence
Identical sequences A2BJU6
gi|124027282|ref|YP_001012602.1| 415426.Hbut_0390 WP_011821575.1.50451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]