SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|124027380|ref|YP_001012700.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|124027380|ref|YP_001012700.1|
Domain Number - Region: 74-168
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00231
Family Hypothetical protein PH1932 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|124027380|ref|YP_001012700.1|
Sequence length 192
Comment putative transcriptional regulator [Hyperthermus butylicus DSM 5456]
Sequence
MVEQETPIKMREVKIPVEVPVRPVSKREIKQLEAVLIIGTLFRPDVLQAALSKEEFLTWV
DSLAVAAAALAMEKAGYTVSQIAEELGRTEATIRRHLKGETKAGKLVRETYDMLIRGELK
LAVPIVSPEAEEELKKLDEQVKQLEEELGKLRAENTELRERLQRLEEAKKKAAEQLGKAI
EALQEAKRALEA
Download sequence
Identical sequences A2BK44
gi|124027380|ref|YP_001012700.1| 415426.Hbut_0493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]