SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|124027381|ref|YP_001012701.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124027381|ref|YP_001012701.1|
Domain Number 1 Region: 170-487
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.88e-112
Family Leucine aminopeptidase, C-terminal domain 0.000000205
Further Details:      
 
Domain Number 2 Region: 30-175
Classification Level Classification E-value
Superfamily Macro domain-like 0.00000000000306
Family Leucine aminopeptidase (Aminopeptidase A), N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|124027381|ref|YP_001012701.1|
Sequence length 490
Comment cytosol aminopeptidase [Hyperthermus butylicus DSM 5456]
Sequence
MSTLLRVGNARNGVDAIAYVAGEKQLEWLKGFGDTVRTVIELGDFKGKLEETILIYESSA
TVKRVILAGAGGNEWFGDAERLRVAVASAVKLARSKKSIKRLGVVVHEELLEKAAETAGR
DTVWSVEQALVAADMANYVYSLREREEKPHILEEVRLEPGDEKAVETAKAIAEAVRVARD
IANAPANRLSPEKLEEKARELASRLGLTIRVLYRSDLESLGMGGILAVGSGSNVEPRLII
LEYNSGGKRIAVVGKAVVFDAGGLDLKPPQAMQEMKFDKSGGAAAIGAVVAAALLRLPVN
MVALVPAVENLPSGRAYKPLDVIRMYNGTTVEIGNTDAEGRLIMADALAYAAEKYKPDYM
FDFATLTGAAVVALGNHAAALFSNNDQLASMVERAAWIAGEPVWKMPLWPVYAKQLESHV
ADTNNVGGRPAGAITAAKFLEKFVGDRPWAHLDIAGTAWVQEKGPWKPYYEKGATGWGVR
TLVEFLRLLI
Download sequence
Identical sequences A2BK45
WP_011821674.1.50451 gi|124027381|ref|YP_001012701.1| 415426.Hbut_0494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]