SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|124027456|ref|YP_001012776.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124027456|ref|YP_001012776.1|
Domain Number 1 Region: 23-194
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.1e-46
Family Ribonuclease PH domain 1-like 0.00000255
Further Details:      
 
Domain Number 2 Region: 163-248
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.14e-25
Family Ribonuclease PH domain 2-like 0.0000363
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|124027456|ref|YP_001012776.1|
Sequence length 255
Comment ribonuclease PH [Hyperthermus butylicus DSM 5456]
Sequence
MAGGAGEKPTLIRWEERDGQKVAIRHDGRLPEQLRPIRMEVGVLSNADGSALVEYGGTRV
IAAVYGPREAHPRHVALPDRAIIRCRYHMAPFSTAERKTPAPTRREVELSKVIREALEAV
VISELYPRTAIDVYMEVLQSDGGTRTAAITAASLALADAGIAMRDLVAGVAVGKVDGVLV
LDIDEIEDNYAEADMPVAMAPSLDKVLLLQLNGVLTHDEFVKALELARKGIQVIYNLQKE
ALRKKYVEVSVEEGA
Download sequence
Identical sequences A2BKC0
WP_011821749.1.50451 gi|124027456|ref|YP_001012776.1| 415426.Hbut_0571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]