SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|124027457|ref|YP_001012777.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124027457|ref|YP_001012777.1|
Domain Number 1 Region: 11-176,205-219
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.87e-54
Family Ribonuclease PH domain 1-like 0.00000357
Further Details:      
 
Domain Number 2 Region: 192-275
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.88e-21
Family Ribonuclease PH domain 2-like 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|124027457|ref|YP_001012777.1|
Sequence length 328
Comment exosome complex RNA-binding protein Rrp42 [Hyperthermus butylicus DSM 5456]
Sequence
MSITPSFQPVIPKLKKHTMETLLSRGVRLDGRKLDETRPVEITPGYIDRAEGSALVKLGQ
TVVLAGVKTDIVAPFPDTPNEAVLVVHAEFVPLASPTFEPGPPDENAIELARVIDRSLRE
IKAVALDKLVLEPGKHVWRLYVDLYILNHDGNLFDASMLAAMAALMTTRLPAAVKTEDGY
TVDRSKFTGLVPVNHKVVTVTIAKLSNRLIVDPTYEEEQVADTRLVVAVSDDGRIAGIQK
TGMGDLTYKEVLTAVAIALNKAQVYLKALEEKVVPYRAELEKKLAEQAAGATPAAAVPAP
AREHEEVVEQAESAGEETVEQSYEEERD
Download sequence
Identical sequences A2BKC1
gi|124027457|ref|YP_001012777.1| 415426.Hbut_0572 WP_011821750.1.50451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]