SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|124027627|ref|YP_001012947.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|124027627|ref|YP_001012947.1|
Domain Number - Region: 20-88
Classification Level Classification E-value
Superfamily Prefoldin 0.018
Family Prefoldin 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|124027627|ref|YP_001012947.1|
Sequence length 103
Comment hypothetical protein Hbut_0748 [Hyperthermus butylicus DSM 5456]
Sequence
MSGYVELKVPRSGLQVLLRAIEAKARRLELEITATLSRIRMFEEKYGMKSEEFLSRYMRG
ELGDREEYMEWYGELVFLEKARKELEELKKIAGTASPRIPGKG
Download sequence
Identical sequences A2BKU1
415426.Hbut_0748 gi|124027627|ref|YP_001012947.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]