SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|124027694|ref|YP_001013014.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124027694|ref|YP_001013014.1|
Domain Number 1 Region: 80-206
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 4.6e-19
Family Homoserine kinase 0.0037
Further Details:      
 
Domain Number 2 Region: 2-86
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.00000000000000205
Family GHMP Kinase, N-terminal domain 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|124027694|ref|YP_001013014.1|
Sequence length 224
Comment homoserine kinase [Hyperthermus butylicus DSM 5456]
Sequence
MGLGSSGATAAATVYAINALLGSPLEPIELVRFAGLAEALTAGAPHYDNVAASLLGGLVI
LLNRKKPRIARLRLPPGMRIVLFIPKTMVLRLLPGKAKTQVMREVLPETIEHSDAVEWVE
KAVALALGLSGADPYEAIKTINYGGPIEATRAKLIPGYWEAKKEALQSGALAFNISGAGP
TLFAVVREGEEDQVMRRVSAVLEKYWGSLEARVVDVDYDGARLE
Download sequence
Identical sequences A2BL08
415426.Hbut_0816 WP_011821987.1.50451 gi|124027694|ref|YP_001013014.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]