SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|124027716|ref|YP_001013036.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124027716|ref|YP_001013036.1|
Domain Number 1 Region: 5-265
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.22e-72
Family G proteins 0.00000387
Further Details:      
 
Domain Number 2 Region: 469-629
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.01e-54
Family Translational machinery components 0.0000171
Further Details:      
 
Domain Number 3 Region: 260-379
Classification Level Classification E-value
Superfamily Translation proteins 5.41e-28
Family Elongation factors 0.0015
Further Details:      
 
Domain Number 4 Region: 630-723
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 3.36e-26
Family EF-G/eEF-2 domains III and V 0.0022
Further Details:      
 
Domain Number 5 Region: 393-469
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 6.12e-22
Family EF-G/eEF-2 domains III and V 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|124027716|ref|YP_001013036.1|
Sequence length 738
Comment elongation factor EF-2 [Hyperthermus butylicus DSM 5456]
Sequence
MRVKHVDEILKIMNNIERIRNIGIVAHVDHGKTTTSDSLLAAAGIISQRIAGEALALDYL
KVEQQRGITVKSANISLYHEYQGKPYVINLVDTPGHVDFSGHVTRSLRLMDGAILVVDAV
EGVMPQTETVLRQSLEERVRPILFINKVDRLIKELKYTPQQIQQRFIEIIKEVNNLIRLY
ADPEFREKWLLNPTSGMVIFGSARDKWGISIPMAQKKGIKFSDIIEAYKKGKDAVEEFAT
KVAPLHEALLDAVVKFIPNPRDAQRYRIPKIWRGDINSEVGKAMLEADPNGPLVYAISFM
RVDPKIRRLVATGRIFSGTLRQGEEVWLINAKKQAKVLQVSIYMGPDREVVDEIPAGNIG
AALGLEDARAGETAVAVEWKEKVSPFEQLKYVSEPVVTVAIEPKDPKDLPKLIDALYKLS
IEDPTLQVKINQETGEYLLSGMGPLHIEIAVWWLKENFGLEVKTSPPIVVYRETIRAKSQ
VFEGKSPNKHNKLYISVEPLDEETIKLIQSGVVREDQDPYERAKILKEKAGWDYDEAKRI
WAIDENINVFVDKTTGVQHLREVKDTIIQGFRLAMKEGPLAKEPVRGIKVVLHDAVIHED
PAHRGPAQIYPAVRNAIFAGMLTAKPTLLEPIQKLDIRVPQEYVSNVIAVISRRRGKIID
MKEYGLMMRIIAEIPVAESFDLAPELRSATQGRAFWGTEFSRWAPVPDNMLMDLVKKIRE
RKGLPPEPPKPEDFISPF
Download sequence
Identical sequences A2BL30
WP_011822009.1.50451 gi|124027716|ref|YP_001013036.1| 415426.Hbut_0840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]