SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|124027750|ref|YP_001013070.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124027750|ref|YP_001013070.1|
Domain Number 1 Region: 10-93
Classification Level Classification E-value
Superfamily Translation proteins 4.68e-25
Family Ribosomal protein L35ae 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|124027750|ref|YP_001013070.1|
Sequence length 106
Comment 50S ribosomal protein L35Ae [Hyperthermus butylicus DSM 5456]
Sequence
MSGEDKRVYTGIILGYRLGSNTQYEKQVLIRVDGVNDRASASRLIGWKVLYRDGKGNEYR
GKIVHVHGSKGVVIAVFKPNLPGQARGGNVYIYPKGIELVFEEEKQ
Download sequence
Identical sequences A2BL64
WP_011822043.1.50451 415426.Hbut_0874 gi|124027750|ref|YP_001013070.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]