SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|124027833|ref|YP_001013153.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124027833|ref|YP_001013153.1|
Domain Number 1 Region: 314-475
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.03e-55
Family DNA gyrase/MutL, second domain 0.00000118
Further Details:      
 
Domain Number 2 Region: 24-234
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.14e-37
Family DNA gyrase/MutL, N-terminal domain 0.000000557
Further Details:      
 
Domain Number 3 Region: 237-309
Classification Level Classification E-value
Superfamily S13-like H2TH domain 0.0000000306
Family Topoisomerase VI-B subunit middle domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|124027833|ref|YP_001013153.1|
Sequence length 535
Comment DNA topoisomerase VI subunit B [Hyperthermus butylicus DSM 5456]
Sequence
MPPKRQRAAVQESFRSMTPSQFFYEYKEVAGFGSPARALYQTVRELVENALDATDVHGIL
PDITIVIERVNENSNYYRITVEDNGIGIQPQYVPYAFGQVLYSSKYKLRQARGRFGLGAK
MAILYGQIRTGRPVEVYTAPIGSRKIYYFKLKIDIEHNRPIVLTKAEYPNPKGWHGTRVS
LVIEGDWWHSKHRVYEYIKRTAIAAPYANIVFIDPNGNVVIYKRSISKLPKQPKEVKPHP
HGVDIELLKQLISGSQAKTMVEFLAEAFRGVGRKTAEAFLEWAGIAKNLDPHSLDDRQLE
LLARKLREYQKFRAPSADALSPFGPEIIEAGLRSILKPEFVAAVTRRPRAYEGHPFIVEV
GIAYGGEIPPTNEPILLRYANKIPLLYDEKSDVAWKVVDPHNFDWRNYLVTFPAPVAVLT
HIASTKVPYKSVGKESVADVPEIEQELRNALREAARRLRGYLLQKRKEEEAKRRIITFMK
YTPEIAKSLAVILKDYNVSEHTVREMLLSAMKRRLRIEDDKFAKLVEGLEVDIEE
Download sequence
Identical sequences A2BLE7
gi|124027833|ref|YP_001013153.1| 415426.Hbut_0960 WP_011822126.1.50451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]