SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|124027887|ref|YP_001013207.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124027887|ref|YP_001013207.1|
Domain Number 1 Region: 4-184
Classification Level Classification E-value
Superfamily FMN-dependent nitroreductase-like 1.1e-54
Family NADH oxidase/flavin reductase 0.0000224
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|124027887|ref|YP_001013207.1|
Sequence length 235
Comment nitroreductase [Hyperthermus butylicus DSM 5456]
Sequence
MSCCIETISRHVSIRKYTDEPVKPEDLEAIVEAARRAPTSWGIQPFTVTIVTDGELKAKL
AEAVGGQEHVAKAPVFLVFSVDYRKLAEAARIHGVEFAEPGLGHLLIGVVDAGIAAGWAA
LAAESLGYGIVFIALYSNPCRIAEILNLPEQVLPVVGLCVGRPAEKPSPKPRQPREVFAA
ENRYIALDEEAARKVAYVFGEKTQRIYSYVLSKGGYYEQVTRRLLECARRRGFRI
Download sequence
Identical sequences A2BLK1
gi|124027887|ref|YP_001013207.1| WP_011822180.1.50451 415426.Hbut_1016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]