SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|124028036|ref|YP_001013356.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124028036|ref|YP_001013356.1|
Domain Number 1 Region: 9-63,206-405
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.66e-24
Family Bacterial dinuclear zinc exopeptidases 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|124028036|ref|YP_001013356.1|
Sequence length 566
Comment hypothetical protein Hbut_1177 [Hyperthermus butylicus DSM 5456]
Sequence
MAVDLFSDVLKLVDGLRGFELVASLARFHRVQGGDDIVVAVEHVGQVLEELGVEVRLEVF
RGPLGLGEFWGFGEPRGWRLGGGRVEVWEDVGGWKTVASVEDTPLTVVVHSPPGSVEERV
RLAAEPADAGEDDIVVSPEFDAYKYYRFAERGVTGIIGTHRGPGVRYWGLFPAFFIEEPR
VPAVSLEYNTAMNLVGKRVRITVESEYHGFPSTPILVARVGPEGAPCIALYAHACHPRPG
AHDNASGVAVLVEALYALKELLGRDSWFSVCGIVVPEYTGSMAVFAQHIVDPQEVVAAVS
VDMVAADLAATGGSLHLVASPLPLASPLDPLLDVFLGHVEGYAGFEFYSVGSDHDVTISL
GIPGSMVNEWPDRYYHTSLDEPGNLSAERLRATAAAIAAAVAALARLGPEKAAKLAGLWA
RHQASKLSARAYAGEPLDMTAAAELEKLAVEHASTRIKALASGGQPEPPWPFEFELSLRA
PMSKLYLYAHRHVEAYRELLKALEDDREKVLQRLLVLGSGTASRRVVELYARGVLGLKHA
EKKADLVVKALTAKPQQRAASGKHEG
Download sequence
Identical sequences A2BM00
WP_011822329.1.50451 415426.Hbut_1177 gi|124028036|ref|YP_001013356.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]