SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|124028153|ref|YP_001013473.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124028153|ref|YP_001013473.1|
Domain Number 1 Region: 508-659
Classification Level Classification E-value
Superfamily vWA-like 0.00000000241
Family Integrin A (or I) domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|124028153|ref|YP_001013473.1|
Sequence length 662
Comment hypothetical protein Hbut_1298 [Hyperthermus butylicus DSM 5456]
Sequence
MGKNQGEEADYKALSLAVAEAARRAGVRVSTSEVVDAARLLALYAAISSKPLSLEDYVAV
FTSVYAKRGEDEQVVVEAVKRVIIGPEAGRASVEQRIKRDLEALGLDYGDKISRHKLSSL
KKSDRARTAYARLKLLGIIRRSRHGEYVVSQEKAKRIMGEIARRYGDIDNALAEAIANSI
ARNTSLASLLGSELLKYLDLESLNLATLAKLYSNLHREKWLQKVITGIISRKIAEGETPP
NPERIYDILRREGMDSRVLAGLLRSNPRLAARAAKDYGFQTVLDIASSIASYDSQRAAEI
LAHASGLKQSQKTFLRNYITRLGVTYALELAKHTGVAQLLARAVQVRESLIRSLSRPEEA
PAHLDMALAEYEKLVSEYNSASSEIPDRLRNIIEGEIRSLASLVHAASTGNTYALLKGLT
RQLPVWQALQFLTDVASASSDPKTKRYALMLALLTWKRAVSTTGPRLSRRRKYTVTRGRL
DARKAIYGILRFDPYTPIYRRRVRTARYVVVLDKSGSMREYSLTALLASASLAPAITRLV
LFDSEVRVIDRLEQASVPKIISLLFKTSFEGYTDVVRALEESTRGLAPSKLVVISDLHQT
VPSRKSVDEVLRGMRTSGWRIAVVAPPTLDPRLARRITGIVKLYTVSKPADVARVIRRLI
AA
Download sequence
Identical sequences A2BMB7
415426.Hbut_1298 gi|124028153|ref|YP_001013473.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]