SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|124028184|ref|YP_001013504.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124028184|ref|YP_001013504.1|
Domain Number 1 Region: 23-255
Classification Level Classification E-value
Superfamily Pseudouridine synthase 3.17e-73
Family Pseudouridine synthase II TruB 0.000000176
Further Details:      
 
Domain Number 2 Region: 256-338
Classification Level Classification E-value
Superfamily PUA domain-like 3.87e-24
Family PUA domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|124028184|ref|YP_001013504.1|
Sequence length 345
Comment H/ACA RNA-protein complex component Cbf5p [Hyperthermus butylicus DSM 5456]
Sequence
MSSELTRKGLEFIESLDKFAGLQRSWIVKVEEDTSPDYGTPPWARPIEKHIRMGVIPLDK
PPGPTSHEVVAWIKRMFGLSKAGHGGTLDPKVTGVLPVALEEGTKVIGLVVHTGKEYMCV
MQLHRPVPEEELRRAINMFVGEIYQRPPLRSSVKRSLRLKKIYEIELLEYNGRYALMRVF
SEAGTYMRKLCHDIGLILGVGAHMRELRRTRSGPFRERNGLVRLQELSEAIYRWKQEGKE
DLLRKYILPIEYAVSHLPKIVVRDTAVDAIAHGANLAVPGIARLHEGIKRGDLVALLTLK
GELVAIGVAQMSSEEIAKAKKGIAVKIRRVIMPPGVYPRAWKKKK
Download sequence
Identical sequences A2BME8
415426.Hbut_1329 gi|124028184|ref|YP_001013504.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]