SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|124028277|ref|YP_001013597.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|124028277|ref|YP_001013597.1|
Domain Number - Region: 52-128
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.000182
Family GHMP Kinase, N-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|124028277|ref|YP_001013597.1|
Sequence length 283
Comment hypothetical protein Hbut_1428 [Hyperthermus butylicus DSM 5456]
Sequence
MWRGSPRETGSLGAGLLLEPPAVAEVYECPGGECGLRVRACGELVSASTSIVKHVVELLG
GLNVDVSLESPAPLAVGYAVSAAIALAIAIGEGSRRGWSVEASAAVAHEAEVLAGTGLGD
VVAMVYGRGLELRLAPGAPGLARVESFPVNAKTIYSLELGRMATTEMHRALGEKLVALAA
PRWQRIAENPNLDTFLREAREFSVEAGFAPDWLREKLDRLVSRGLVRGWYVKKRVAIVVP
EDDAAGEAREELEALAAKRGLRLRRHRPAGSPLSVEPCYSSFM
Download sequence
Identical sequences A2BMP1
415426.Hbut_1428 gi|124028277|ref|YP_001013597.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]