SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|124028318|ref|YP_001013638.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124028318|ref|YP_001013638.1|
Domain Number 1 Region: 12-198,330-412
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.51e-67
Family Bacterial dinuclear zinc exopeptidases 0.00058
Further Details:      
 
Domain Number 2 Region: 198-324
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 7.78e-19
Family Bacterial exopeptidase dimerisation domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|124028318|ref|YP_001013638.1|
Sequence length 415
Comment succinyl-diaminopimelate desuccinylase [Hyperthermus butylicus DSM 5456]
Sequence
MSSSGGSEELYVVRLLEKLISVPTVNPPGENYQEMATLLREELEALGLEVSIVRVPDDVV
EKYYPWAQGYPRFIVVARLYSGAEEQPVLHFNGHYDVVPPGQGWSLDPFKPVVRDGKVYG
RGASDMKGGIAAIIAAVRSLVEQGWRPRKGVLELSFTPDEETGGETGVGYMLEEGIALPD
YAVVAEPSTTERIWIGSRGNLWLNVHIYGKQAHGSTPWSGLNAFEGMVEIAYRLIHEYKP
LLEERKTDLPMDDPRAAKPTVTLGGEVQGGAKTNIVPGYYRFSIDRRIIPGENPDEVEKE
LREFIDRVSAPLRARGYRVEVEVTAKAPATWIPPDHNFVELVASTIRDMLGIEPLRTICV
GGLDTRYFQLRGIPAVTYGPGALDAAHKPDEYVPIEELVRAKKVYMELAKRVLGA
Download sequence
Identical sequences A2BMT2
gi|124028318|ref|YP_001013638.1| 415426.Hbut_1469 WP_011822611.1.50451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]