SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|124028347|ref|YP_001013667.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124028347|ref|YP_001013667.1|
Domain Number 1 Region: 9-53
Classification Level Classification E-value
Superfamily PIN domain-like 0.00000107
Family PIN domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|124028347|ref|YP_001013667.1|
Sequence length 76
Comment hypothetical protein Hbut_1500 [Hyperthermus butylicus DSM 5456]
Sequence
MRFVKASSLETLRVAYELGITFYDASYVVAAGMLDAVLVTDDGELRKRVRSMEKTVVELL
GRRIETISSRELLGTG
Download sequence
Identical sequences A2BMW1
WP_011822640.1.50451 gi|124028347|ref|YP_001013667.1| 415426.Hbut_1500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]