SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|124028500|ref|YP_001013820.1| from Hyperthermus butylicus DSM 5456

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124028500|ref|YP_001013820.1|
Domain Number 1 Region: 324-439
Classification Level Classification E-value
Superfamily Pseudouridine synthase 0.000000000187
Family Pseudouridine synthase II TruB 0.011
Further Details:      
 
Weak hits

Sequence:  gi|124028500|ref|YP_001013820.1|
Domain Number - Region: 166-203
Classification Level Classification E-value
Superfamily THUMP domain-like 0.00732
Family THUMP domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|124028500|ref|YP_001013820.1|
Sequence length 441
Comment putative pseudouridylate synthase [Hyperthermus butylicus DSM 5456]
Sequence
MTGVHSDGVEAVITGIASKALRLLEEIPLCDSCLGRMFGLLGRGFSNEERGRALKTLLVM
SLHARIREGDAGAREQLRRLAPNIGELAAKLYEEVFGEKLVPNRCYICESRLQEMISLAV
KRARHMLEGLEFRGFIVAARVNDEVRFREDEVKRRFSLEYAESIGSEVKREVGKKLQQLI
GVKPDFEKPDVVVLVHVPEGRVELQVMPLLLRGWYWKLARRVSQSAWVTRRGERRYPFSV
EDGLFILAEVFEADNIVIHASGREDADARMLGTGRPFIVEAKRPRKRISGLAVAEVEANS
YAAGLVEYKLLSEARRSDVASIKGETQHRAKLYKALVVVERPISEDELKGLEEAFHMRSI
MQRTPRRVRHRRPDVVREKIVFSVKTRQLADNVFEAIIHAEGGLYIKELVSGDGGDTRPS
FAEYFSARAYCAELDVLGVFS
Download sequence
Identical sequences A2BNB4
415426.Hbut_1661 gi|124028500|ref|YP_001013820.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]