SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118618736|ref|YP_907068.1| from Mycobacterium ulcerans Agy99

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118618736|ref|YP_907068.1|
Domain Number 1 Region: 27-152
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.0000000000000606
Family HD domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|118618736|ref|YP_907068.1|
Sequence length 211
Comment hypothetical protein MUL_3424 [Mycobacterium ulcerans Agy99]
Sequence
MQSVPELVDTTVAQAALRLSRSTESPAVFNHSVRSYLFGELLAAHDGMRHGVDYDSQTLF
LGCVLHDLGAGSAAPGKARFEVEGADLAAALLGEHGCDNEVVDTVWEAIALHTFFGIAER
RGPICYLVHAGVGMDFGRNAEFVDDRTAALIHDQYPRLSMATTLVDAITTHAQRSPEAAP
PYTVPGGLLLERRTNGITALEQLESLGRWGE
Download sequence
Identical sequences A0PTC8 X8EYP2
gi|118618736|ref|YP_907068.1| 362242.MUL_3424 WP_011741203.1.20315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]