SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118618981|ref|YP_907313.1| from Mycobacterium ulcerans Agy99

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118618981|ref|YP_907313.1|
Domain Number 1 Region: 2-108
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.8e-24
Family alpha-D-mannose-specific plant lectins 0.00018
Further Details:      
 
Domain Number 2 Region: 159-207
Classification Level Classification E-value
Superfamily LysM domain 0.0000000484
Family LysM domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|118618981|ref|YP_907313.1|
Sequence length 207
Comment hypothetical protein MUL_3720 [Mycobacterium ulcerans Agy99]
Sequence
MSDTLTEGQQLVPGESLVSKNGAYTLTLQDDGNLVLASRGTPLWASATNGQQVVRAEVQR
DGNFVVYTADKPVWHTDTKGKKNVRLVLQDDRNLVLYAADGPAWSTHTETDAPPPPEPTA
AAEATASDTAQRVDTTPEAVAAAVAEPAPPEPAAEPAPRTYTVVSGDTLWAIAERFYGDG
SKYQVIAEASGVANPDLIHPGEVLTIP
Download sequence
Identical sequences A0A100IBR5 A0PU23 L7V725
gi|443491996|ref|YP_007370143.1| 362242.MUL_3720 WP_011741447.1.20315 WP_011741447.1.33562 WP_011741447.1.39490 WP_011741447.1.5386 gi|118618981|ref|YP_907313.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]