SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPrPV00000018014 from Pythium vexans DAOM BR484 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPV00000018014
Domain Number 1 Region: 69-86,122-183
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000235
Family Pseudo ankyrin repeat 0.023
Further Details:      
 
Weak hits

Sequence:  EPrPV00000018014
Domain Number - Region: 28-86
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0547
Family Ankyrin repeat 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EPrPV00000018014
Sequence length 241
Comment pep:novel supercontig:GCA_000387545.2:pve_scaffold_261:28343:29068:-1 gene:maker-pve_contig_261-snap-gene-0.19 transcript:EPrPVT00000018014 description:"Conserved gene of unknown function."
Sequence
MELAAVTSVCREHPRIHALNHVVECLDQLLDYSHRWTIPQAAQRGHFFLVVRLWTRNSTS
KKAKLLNKAMVKAAKYGHLDIMQWIHYSVFQPSGCELHGVLSKAVAAGNVDVADWVDIHY
SDDQCEPMAIVRATRDGNLDMIQWIVRRRPMEWLVVVAFFDPLMEAATHGHLPVVQWLWR
WTKAARRSDLEQTAAEHGHVHVSQWLALESAKSRAADTVLLPRIGSSQRTTAPTGGRMRV
A
Download sequence
Identical sequences EPrPV00000018014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]