SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPrPV00000024228 from Pythium vexans DAOM BR484 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPV00000024228
Domain Number 1 Region: 236-337
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000392
Family Pseudo ankyrin repeat 0.015
Further Details:      
 
Domain Number 2 Region: 98-176
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000432
Family Pseudo ankyrin repeat 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EPrPV00000024228
Sequence length 351
Comment pep:novel supercontig:GCA_000387545.2:pve_scaffold_1926:764:1877:1 gene:maker-pve_contig_1926-snap-gene-0.0 transcript:EPrPVT00000024228 description:"Conserved gene of unknown function."
Sequence
MSDLHRPRTRLKREVRTSSDMLPTLTSVAVVCRAHPAIDGIDAVVRLIDAYFDPASRWTL
PEATKKVSTGRLRLLKRVAANDPADMEPLFKHEQFSSALVHVVRLGDQCVVEWLVEQYLP
TGRIRQAVNEAVKCGQLVILQWFVERHASRTIWSGYELVEALNRNDSVMVRWLIEHSGWY
YGFNAIDMGHFLEYMTKYGDLGMVKWVYEECQARGVRIEADRLKEVFYWIGAVGRDDLME
YLAKKVHERYGVRHINAKCLVEPASCGKTELIEWTLSNCTLDDRGWLGPAFASAAESGHI
DIVQCFCKKFGMRFATHAVSRAAKNGRLEVIKWAHENLNGVWWSRAIDEAV
Download sequence
Identical sequences EPrPV00000024228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]