SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPrPV00000014061 from Pythium vexans DAOM BR484 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EPrPV00000014061
Domain Number - Region: 102-143
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000183
Family Pseudo ankyrin repeat 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EPrPV00000014061
Sequence length 148
Comment pep:novel supercontig:GCA_000387545.2:pve_scaffold_26:73:519:-1 gene:maker-pve_contig_26-snap-gene-0.41 transcript:EPrPVT00000014061 description:"Conserved gene of unknown function."
Sequence
MEYHRLDPADERGASETRQTTTRDPPQLLTCVVVACRENARVAAIHEVVQQIDAFVDSTR
SCSLVRACDAAPIGLIRLVRRIAAREPEDIDPLAKHQIFTRALDHAVRHGDLKIVQWLVD
EYLPTGKIRQPLNKAAASGRLEIHLLRS
Download sequence
Identical sequences EPrPV00000014061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]