SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPrPV00000016856 from Pythium vexans DAOM BR484 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPV00000016856
Domain Number 1 Region: 216-545
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.49e-27
Family Ankyrin repeat 0.0033
Further Details:      
 
Domain Number 2 Region: 66-232
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000432
Family Pseudo ankyrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EPrPV00000016856
Sequence length 621
Comment pep:novel supercontig:GCA_000387545.2:pve_scaffold_167:28401:30266:-1 gene:maker-pve_contig_167-snap-gene-0.29 transcript:EPrPVT00000016856 description:"Ankyrin."
Sequence
MGESLSPLTSVVAVCRSHPRVAAIDEIICRVDAFIDPALSLSVPKACEKISSGLVRFLER
VAVHEPNDINPFHKHQNFTRAMVLVVQRGDLQAVRWLVETYLPTGKIRKPVREAAECGRL
EILQWLWANHATRLVWSGSECDLAAKNNHFETLQWLDAFVDQLQRNRVAEIDRYDLSQIL
SYAGEHGSIEMARWVDEQRRRKNISLSGDYVEPGMVQAARNGHRDVLEYLCECFLVPYPN
KCLTEAIRGQHLELAQWLHADIGIGVYHTHDLLNAAKCGNLDLFQWVKRRELKPINLDRL
LLVINSAAAAGYLDVIRHLHDNFDEAGLWVDAMNLAAEYGRLDVVIWLHKHRTEGCTFYA
MDSAARNGHLETVQWLHDNRTEGCTTEAMIGAAQCNHLDVVKWLHANRSEGCTPRAMDTT
ALNGHLEVVQWLHENRSEGSSMLAMNYAAWSGHLGMIKWLHDNRSEGCTTSAMDNAARNG
HLDVVKWLHANREEGCSSRAFHKAAQNGHIDVMKWLLANKPGEFDIDTMNYAVAEDNFEV
LAVVHAFAERNVPGYAPQIEWFRTALNRRNFEMVEWLGHEYGGNTPGYHYWLREKCHGRL
LPDPYAQELTERMQASREASQ
Download sequence
Identical sequences EPrPV00000016856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]