SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPrPV00000023169 from Pythium vexans DAOM BR484 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPV00000023169
Domain Number 1 Region: 331-568
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.71e-31
Family Ankyrin repeat 0.0014
Further Details:      
 
Domain Number 2 Region: 90-145,178-231
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000000863
Family Pseudo ankyrin repeat 0.028
Further Details:      
 
Weak hits

Sequence:  EPrPV00000023169
Domain Number - Region: 215-319
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0828
Family Ankyrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EPrPV00000023169
Sequence length 643
Comment pep:novel supercontig:GCA_000387545.2:pve_scaffold_1109:4783:6714:-1 gene:maker-pve_contig_1109-snap-gene-0.1 transcript:EPrPVT00000023169 description:"Ankyrin."
Sequence
MIAATQDPSSQRVVPLTGVAVVCREFSDVSAFPDDVVRLIDEFVDPSPTFRLVDVAARAP
PGLLRLMQRIARNDAEDLEWLFKHQIFARSLVHAVRHGDLSVVQWLVEEYEPCAKIRQAL
NEAVTCGQLEILAWLAENHESRLVWNGRELQRAARGNHLWMTIGLFECSRQFDGDDANNL
SKVLLHSAANGNLDMAKWVAEQCRLRDVRLDPVDALVVSATNGHRGLTEYIWEQFDGSFT
QRHFDSAIGGGNLEIVKWLHARRGYSWANMHYLSKAAKTGNTALAEWVLDNIKLKYYGFG
WLIGDVATAGHLDLVKLFYKHLEGSCSTRVMDNSATNGHLEVVKWLHANLSEGCTFRALD
GAATNGHLEVVKWLHANRSEGCTFRALDGAATNGHLEIVKWLHTNRSEGGSPNAMIWAAA
NGHLDVLQWLHANRHDGSSFVAMDEAAKHGHLEIVKWLHQNRHEGCSKQAMMNAAMNGHL
LVVKWLHENRSEGCTSGILSNAAANGHLHVVKWLCANQLARSWSSGIHGAARGGHFEVVK
WLLAHNQGNKLGPGALIAAVDGGNFEIVLAIDQVVRSFVQPSVKLFRRACRESHVEILLW
LIREYGDRTPGLEDNLRRRMRSNQFDPYIRDIVQDLLSLRDAP
Download sequence
Identical sequences EPrPV00000023169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]