SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|159899195|ref|YP_001545442.1| from Herpetosiphon aurantiacus DSM 785

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159899195|ref|YP_001545442.1|
Domain Number 1 Region: 4-124
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 1.57e-27
Family Thiamin pyrophosphokinase, catalytic domain 0.0026
Further Details:      
 
Domain Number 2 Region: 146-206
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 0.000000000523
Family Thiamin pyrophosphokinase, substrate-binding domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|159899195|ref|YP_001545442.1|
Sequence length 217
Comment thiamine pyrophosphokinase [Herpetosiphon aurantiacus DSM 785]
Sequence
MLAVIIADAPQADIRAALPLLSSTDLLIAADGGARHALNHGVTPHVIIGDLDSIQPATLE
IMQARKVEIQRFPAAKNETDLELALLLAAERGADQIRILAALGGRPDMHMANQLLLTHPA
LIGRDVALLDANWEVRLIRDQLQLQGKLGLRVSLLPLGDVAGVRTEGLRYPLRDEDLPIG
PARGVSNEFATESAQVSIRSGLLLAMIERELQSGYLA
Download sequence
Identical sequences A9B136
316274.Haur_2676 gi|159899195|ref|YP_001545442.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]