SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|159900207|ref|YP_001546454.1| from Herpetosiphon aurantiacus DSM 785

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159900207|ref|YP_001546454.1|
Domain Number 1 Region: 146-328,365-438
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.94e-23
Family Carboxylesterase 0.0059
Further Details:      
 
Domain Number 2 Region: 38-111
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00000824
Family Starch-binding domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|159900207|ref|YP_001546454.1|
Sequence length 441
Comment esterase [Herpetosiphon aurantiacus DSM 785]
Sequence
MWLTLILFVVGLGLAFGLGVMVGRQRGFALFSAPEATPLVNFEFKIPADTAPGDQLYLTG
SFNQWRPNDPTYVLSRSADIAYGAWPFTNGLRLDFKLTRGSWSNVEKAADGSEMPNRTGI
AASGAQVKGTVAAWADRQRDAAKIYDERVERVDFFSQALGITRTFYIYLPIETRSDENLR
VPSLYLFRGHEREWINKTEDGTRGGNRNVIDVYEELRRQDQIGPMVMVFPGMTNANDGIH
SLGINLHSPELVADPSIGTGLFEDFIYRDLIPYVETHYPVLFGGAHRSLDGFSLGGFISV
NQALRHPNEWASVGAYDGLFFWDDPENAEIIAARDSVFERNLFDANFGVPRDHTFAAQHN
PLTLLRIDGAQASKLQWLIEYGPESAEPNVNYYRGARLDELLREVGAHNRLSGVVPNANH
SWQMADEHMRRSLPYHYQQTQ
Download sequence
Identical sequences A9B6B5
gi|159900207|ref|YP_001546454.1| 316274.Haur_3690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]