SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|159900578|ref|YP_001546825.1| from Herpetosiphon aurantiacus DSM 785

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159900578|ref|YP_001546825.1|
Domain Number 1 Region: 40-390
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.68e-86
Family Amylase, catalytic domain 0.00000000503
Further Details:      
 
Domain Number 2 Region: 499-595
Classification Level Classification E-value
Superfamily Starch-binding domain-like 2.33e-34
Family Starch-binding domain 0.0001
Further Details:      
 
Domain Number 3 Region: 397-485
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.32e-33
Family alpha-Amylases, C-terminal beta-sheet domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|159900578|ref|YP_001546825.1|
Sequence length 596
Comment alpha-amylase [Herpetosiphon aurantiacus DSM 785]
Sequence
MSRTTRAMARLTLFVLVVIIFSVGFFGTAPRATQAQTTPRTAFVHLFEWKWTDIAKECEN
WLGPKGFAAVQVSPPQEHIQGSQWWTRYQPVSYQIQSRSGTRAEFANMVSRCKAVGVDIY
VDAVINHMTGVGSGTGVAGSSYTSYNYPGNYQTQDFHHCGRNGNDDISNYQDRWEVQNCE
LVNLADLKTESDYVRGKLAAYLNDLRSLGVAGFRIDAAKHMPAADIANIMSRASNPYIYQ
EVIDQGGEPITSGEYTGNGDVTEFKYSTNIGRMFKTDKLANMSNFGTAWGFIASDSAVVF
TDNHDNQRGHGGAGNVVTFKDGKLYELANVFALAWPYGYPQVMSSYNFSNGDQGPPSSNV
YNGNTADCGGSNWVCEHRWRGIANMVGFRNYTSTAFSTSNWWSNGNNQISFSRGSLGFVA
INREGSSLSRTFATGLPAGTYCDVIHGDFNNGSCSGPTISVNSSGQATITVAAMDSVAIH
GGAKINGTNPTPVPTTPPSGSIAVTFNENATTVWGQNVYVIGNVSALGSWNTANAVLLSS
ASYPVWSKTINLPASTAIEYKYIKKDGSGNVTWESGSNRTFTTPSSGTVTRNDTWK
Download sequence
Identical sequences A9AVU7
gi|159900578|ref|YP_001546825.1| 316274.Haur_4065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]