SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|159900848|ref|YP_001547095.1| from Herpetosiphon aurantiacus DSM 785

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159900848|ref|YP_001547095.1|
Domain Number 1 Region: 554-642,686-945,972-1107
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.51e-88
Family Amylase, catalytic domain 0.000000694
Further Details:      
 
Domain Number 2 Region: 482-596
Classification Level Classification E-value
Superfamily E set domains 1.1e-26
Family E-set domains of sugar-utilizing enzymes 0.0028
Further Details:      
 
Domain Number 3 Region: 1199-1285
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000016
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 4 Region: 1108-1192
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00000000585
Family alpha-Amylases, C-terminal beta-sheet domain 0.011
Further Details:      
 
Domain Number 5 Region: 1420-1511
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000221
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 6 Region: 1517-1614
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0000000294
Family Starch-binding domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|159900848|ref|YP_001547095.1|
Sequence length 1753
Comment alpha amylase [Herpetosiphon aurantiacus DSM 785]
Sequence
MRDTAHRRSLISRMLLIVMLLSLMIPTFSQQTPVVAAQPATFDLALNQAPTIANAQVNWC
FAGGFQNWDNAATPANDEGLNGDLVAGDGIYSLDVEIATAGRSEWKAVVCGSWETSVPAG
PNAWMNTTQANQTVKLTLDTNNYSSNAGNHGVPSNNIIHAYDSDFASWTAVGSFQNPVWT
NNDPATAMTSLGNGWYYLAYTVPNAGTYEGKVVHTGDWTTQYTGVGRAADQGNISFTTTQ
AGQMVVFLLDTNTSRLTIRPQTAGNAGPWCAPGTYQTPQWQETGSPLVDNGTQGDLVSGD
GVFSLDVVIPAAGTYEWKVNACNWATAFPAANAWIYTDQPNQTVKLLFDSNNHAADNGWD
LLPTQNVVNAIDASNDFTVVGAFQGWSNNNPATKMIQIAPNQFVLHYTIAAPGDYAAKFT
RTGSWVEQYNAQGRVFDANDPAPIGFTTTNLNETVVFYLDNRTGRVAITPQRDGQVPDSV
IGDGLINRDAIEHHSRESLYRVPFGAAPLNQAVNLRLRTAAHDINQARIRLYYTANNGQS
IQRMTKVASDEMYDYWEYTMPAQTALGVVYYRFIIEDGATTLFYEDDNRFDGGLGEVVNA
SADRSWNIYIYDPAFTTPEWAQNATIYQIFVERFRNGDTSNDPTGVATDTTYPGRGWFYP
TERGHRFPVTPWNSIVPDPEPFTDQNNPWWSTYSSTMYGGDLNGVQDKLDYLQDLGVTTL
YLNPIFDSPSNHKYDGRNYRTVDPAFGGQQAFDDLVADAHGRGMTVVLDGVPNHVSSDSP
FFDRFGRHAEVGACESTSSPYRTWFFFEPAAEPGTGVCAGDTNYRGWFGVATLPQINTNH
PEVMAYWFGTAGGNPNLPTNTASYWVDGTNKADGWRIDVVPDVIGVNPTFFETWRDVMKA
ANPDAVLYSETWSEGDVRDRVLGDEFDSTMNYRYRRAVLGFLRDTRWVDNDGGQEIDPLL
PSQFVNSFETIREDYPEPAYNAAMNLIDSHDTNRAVHVLNELGFTGTGYDRQPVDNFVDA
RHRLSLVAALQMTLPGAPTIYYGDEVGLTGYGFDVPRDDPYNRQPYPWTDQAGYNSLPEW
RKADTNLLATYQRLGQLRRDYSYLRTGSFDVMTANDANKVLAYGRKDENGAAIVVFNRDS
QAHSIELNLAGYVPTGTVLTRTMPLTQTGLLPATDVTTYTFSVAPQSVGIWLTPDSVDMS
APAAPTNLQVTNQLSQSIELGWNSVATAESYNIYRSIVSGGGYELVGNTTSTSFSSADLT
PGQRYYYIVKAVRNGLESTASNEVSGLPAYVINWSNLQFPATINHTISITNPTTNIYGQV
YIAGVTSEVGATPSVLAEVGYGPDGSQPNTASWTWFDANFNVQNGNNDEYVGNLLPSSVG
TFDVAYRYSTDGGTSWIYADLDGSDNGYSPAQAASLVVAASSDTTAPTAPLNLREVRRSA
SQIVIGWDVSSANDTYRYDVYRDGNAIASVLHPTTIFTDTEVTAGITYTYQLKALDGSFN
QSEFSNSVSIRAEQRVIDVTFRVKVPVETPTNESVYIAGNDGTVFNGAWTANGQIMQRVL
TDTWEFNKQILEGTALEYKYTRGAWERVESWGTIEAFTNRRVTIEYGNNGHFIVDDTDTN
WGTGDDNRKAVQAWRDPLVSSSSIANNAVEVAPTVQPAITWSQVVTTTTPISQVLVLTNA
QNQSVAGTVVATSPTTFSFIPAAPLPNGTYTLTAFNVRRVIGDPSPMQQRYVVRFTVGRD
ILKIFLPIVGRSN
Download sequence
Identical sequences A9AY85
316274.Haur_4335 gi|159900848|ref|YP_001547095.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]