SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|157362881|ref|YP_001469648.1| from Thermotoga lettingae TMO

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157362881|ref|YP_001469648.1|
Domain Number 1 Region: 278-541
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.49e-64
Family Tandem AAA-ATPase domain 0.0000000186
Further Details:      
 
Domain Number 2 Region: 480-690
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.4e-45
Family Tandem AAA-ATPase domain 0.000000707
Further Details:      
 
Domain Number 3 Region: 106-275
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.25e-43
Family RecG "wedge" domain 0.00000888
Further Details:      
 
Domain Number 4 Region: 1-100
Classification Level Classification E-value
Superfamily RecG, N-terminal domain 3.4e-34
Family RecG, N-terminal domain 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|157362881|ref|YP_001469648.1|
Sequence length 783
Comment ATP-dependent DNA helicase RecG [Thermotoga lettingae TMO]
Sequence
MFTMHPILVEEFLDFLEQSLLEVLHGKKGTNELVEEVQDRYELVADHVLQNSEILEKFKQ
LFEYIEPVADMQPERAIKRVKNSLGMIERFRDWYLISNPDCSQMKQPSCEIKYAKRVGPR
KEAILKKLGISTLGDLIFYFPRDYEDRRKIIPISEISFEGKLTTRGKVVNVETKKIGSMT
ITAAVLADGVSQLLLKWFNQEYLHKGLQVLKNKTIYATGLVKHSQFGGIEMVNPEIEPED
GTQVLEILPIYPLTHGISQKEIRRIVRENISCVCHYTDELPEELMKKRKLMDISRALLGI
HFPKSNYHLKKSIERLAYEELFLMQFALLLSRKSFEEIGGLPKKIPGKLAEEFLRKLPFK
LTDSQKEAHRQIRADLMSNKPMSRLLQGDVGCGKTVVAQLAIVDNFEAGFQSAVMAPTSI
LAMQHYRRMSPAFEEMGIRTALLLGETSSREKEKIKRMLSDGEISVVIGTHTLIQEDVSF
SNLGLVIIDEQHRFGVKQREALVSKGKALDTLVMTATPIPRTLALTIYGDLDITVIDEMP
PGRKDVKTMLVSVSKLEQVYEFVKKEIAEGGQVFIVYPLIEESDKIQAKAAIRMHEYLSK
KIFGEFRVGLLHGKMSQQEKDKIMERFATGEFDILISTTVIEVGIDVPRATVMIIENPER
FGLAQLHQLRGRIGRGDKQGYCFLVVGNVDDDALERLRYFSMTKNGFEVAEYDMKLRGPG
EILGLKQHGLPELKIADLIRDRELLFRARNDAEEIVRKKEQYPDIVKKVKTIYGERLKLV
KIA
Download sequence
Identical sequences A8F350
416591.Tlet_0011 gi|157362881|ref|YP_001469648.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]