SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|549706233|ref|YP_008632775.1| from Genome sequence of Rhizobium sp. strain IRBG74

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|549706233|ref|YP_008632775.1|
Domain Number 1 Region: 3-124
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 1.77e-24
Family Intron-encoded homing endonucleases 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|549706233|ref|YP_008632775.1|
Sequence length 178
Comment putative Prophage LambdaSa2, HNH endonuclease family protein [Rhizobium sp. IRBG74]
Sequence
MAEAWLPVCGFEGFYEVSNLGRVRSVDRTVTRDYGDGRTTTVRRRGAIMKFDYRDGYATV
RMQAEGRSFKGYVHRLVCAAFNGPQPTPEKSMVAHNDGDFTNNTPENLRWATPAENQRDR
ECHGTHNRGERSHLRKLTWDDVYDIRESSEPNPHVARRFGVTSANIRMIRRMKTWIPL
Download sequence
Identical sequences U4Q843
WP_022556403.1.72007 gi|549706233|ref|YP_008632775.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]