SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|160881867|ref|YP_001560835.1| from Clostridium phytofermentans ISDg

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|160881867|ref|YP_001560835.1|
Domain Number 1 Region: 278-465,526-563
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.88e-43
Family Type II chitinase 0.0084
Further Details:      
 
Domain Number 2 Region: 80-150
Classification Level Classification E-value
Superfamily Copper amine oxidase, domain N 0.00000562
Family Copper amine oxidase, domain N 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|160881867|ref|YP_001560835.1|
Sequence length 567
Comment glycoside hydrolase family protein [Clostridium phytofermentans ISDg]
Sequence
MKKRTKLAFIGTIAVVVVVLAIVVSYIVEKNTPSKEVKALSEFYQVPEGEAMVIMDDIVY
ERNAKLLDGVLYMDLETIKVKFNQRFYWDAIENVLIYTTPTEIIKAEVGTKDYLVNKNKV
SSNYPIVKMVNTEVYVALPFVAEYSDMRYKAYENPDLVVIQCKWGDYLFADVENATQIRT
GASIKSPILKELNKGDRVLLINNGGNQQNGFLTVMTEEGIRGFVRKKNLSNSYYDKVTSN
FEAPVYESITKDYKINLTWHQVTNQEANKKLAEVLDSTKGVTTISPTWYRINSAEGTLAS
LASESYIEKAHSMGIEVWALVDNFDPTVDTFEVLSKTSSRERLINELIAQAIKYNLDGIN
IDFESLSVETGPHYIQFLRELSVKCRSNQIVLSSDTYVPASYSKFYDRQEQGAVLDYVII
MAYDEHHSKSEEAGSVASIGFLQKAIEDTLLQVPKEKLIMGIPFYARLWKEYTELGNPAL
ASEAVSMTSAEKTLEANKATKSWDQTTGQYYAEYEKDGAKYKIWLEEEESIEAKLKLISE
ADLAGVASWRLGFEKPSIWNVIQKYVN
Download sequence
Identical sequences A9KKA5
gi|160881867|ref|YP_001560835.1| 357809.Cphy_3749 WP_012201744.1.8979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]